ADAM23 Rabbit Polyclonal Antibody

CAT#: TA339376

Rabbit Polyclonal Anti-ADAM23 Antibody

Product Images

Host: Rabbit; Target Name: ADAM23; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ADAM23 antibody is: synthetic peptide directed towards the N-terminal region of Human ADAM23. Synthetic peptide located within the following region: SAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: ADAM metallopeptidase domain 23
• Database Link:
  NP_003803
  Entrez Gene 8745 Human
  UniProt ID O75077
• Background: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. It is reported that inactivation of this gene is associated with tumorigenesis in human cancers. [provided by RefSeq, May 2013]
• Synonyms: MDC-3; MDC3
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Dog: 92%; Rat: 79%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Protease, Secreted Protein, Transmembrane