SLD5 (GINS4) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of GINS complex subunit 4 (Sld5 homolog) (GINS4)
USD 436.00
Recombinant protein of human GINS complex subunit 4 (Sld5 homolog) (GINS4), 20 µg
USD 867.00
Other products for "SLD5"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GINS4 antibody is: synthetic peptide directed towards the N-terminal region of Human GINS4. Synthetic peptide located within the following region: TEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 26 kDa |
Gene Name | GINS complex subunit 4 |
Database Link | |
Background | The yeast heterotetrameric GINS complex is made up of Sld5, Psf1 (GINS1; MIM 610608), Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex. [supplied by OMIM, Mar 2008]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AK095334.1, BC005995.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025087, ERS025093 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. |
Synonyms | SLD5 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 80%; Pig: 79%; Horse: 79%; Bovine: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.