PUS7 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7)
USD 436.00
Recombinant protein of human pseudouridylate synthase 7 homolog (S. cerevisiae) (PUS7), 20 µg
USD 867.00
Other products for "PUS7"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PUS7 antibody: synthetic peptide directed towards the N terminal of human PUS7. Synthetic peptide located within the following region: FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 75 kDa |
Gene Name | pseudouridylate synthase 7 (putative) |
Database Link | |
Background | The function remains unknown. |
Synonyms | FLJ20485; KIAA1897; MGC17720 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Zebrafish: 93%; Guinea pig: 93%; Yeast: 77%; Goat: 75% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.