APOBEC3B Rabbit Polyclonal Antibody

CAT#: TA339274

Rabbit Polyclonal Anti-APOBEC3B Antibody

Product Images

WB Suggested Anti-APOBEC3B Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: APOBEC3B; Sample Tissue: HepG2; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration:

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-APOBEC3B antibody: synthetic peptide directed towards the N terminal of human APOBEC3B. Synthetic peptide located within the following region: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: apolipoprotein B mRNA editing enzyme catalytic subunit 3B
• Database Link:
  NP_004891
  Entrez Gene 9582 Human
  UniProt ID Q9UH17
• Background: This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. A hybrid gene results from the deletion of approximately 29.5 kb of sequence between this gene, APOBEC3B, and the adjacent gene APOBEC3A. The breakpoints of the deletion are within the two genes, so the deletion allele is predicted to have the promoter and coding region of APOBEC3A, but the 3' UTR of APOBEC3B. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2012]
• Synonyms: A3B; APOBEC1L; ARCD3; ARP4; bK150C2.2; DJ742C19.2; PHRBNL
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 91%; Horse: 91%; Zebrafish: 90%; Bovine: 82%; Rabbit: 82%