Timm17a Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "Timm17a"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Rat |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-Timm17a antibody is: synthetic peptide directed towards the N-terminal region of Rat Timm17a. Synthetic peptide located within the following region: DCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 18 kDa |
Gene Name | translocase of inner mitochondrial membrane 17 homolog A (yeast) |
Database Link | |
Background | human homolog is a translocase in the inner mitochondrial membrane [RGD, Feb 2006]. Sequence Note: This sequence has been modified as follows: removed 46 bp suspected to be vector contamination from the 3' end. ##Evidence-Data-START## Transcript exon combination :: AB006450.1, DV715276.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SRS369727 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END## |
Synonyms | MIMT17; TIM17; TIM17A; TIMM17 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.