TSPAN2 Rabbit Polyclonal Antibody

CAT#: TA339024

Rabbit Polyclonal Anti-TSPAN2 Antibody

Product Images

WB Suggested Anti-TSPAN2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSPAN2 antibody: synthetic peptide directed towards the middle region of human TSPAN2. Synthetic peptide located within the following region: FAFIGKGVAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: tetraspanin 2
• Database Link:
  NP_005716
  Entrez Gene 10100 Human
  UniProt ID O60636
• Background: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008]
• Synonyms: NET3; TSN2; TSPAN-2
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 86%; Rabbit: 86%; Dog: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane