eIF1A (EIF1AX) Rabbit Polyclonal Antibody

CAT#: TA338990

Rabbit Polyclonal Anti-EIF1AX Antibody

Product Images

WB Suggested Anti-EIF1AX Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 2500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF1AX antibody: synthetic peptide directed towards the middle region of human EIF1AX. Synthetic peptide located within the following region: KYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: eukaryotic translation initiation factor 1A, X-linked
• Database Link:
  NP_001403
  Entrez Gene 1964 Human
  UniProt ID P47813
• Background: This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq, Jul 2008]
• Synonyms: eIF-1A; eIF-4C; EIF1A; EIF1AP1; EIF4C
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 92%