Fbx15 (FBXO15) Rabbit Polyclonal Antibody

CAT#: TA338901

Rabbit Polyclonal Anti-FBXO15 Antibody

Product Images

WB Suggested Anti-FBXO15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: OVCAR-3 cell lysate

• 

  FBXO15 antibody - N-terminal region validated by WB using 293T cells lysate at 1: 500.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FBXO15 antibody: synthetic peptide directed towards the N terminal of human FBXO15. Synthetic peptide located within the following region: QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: F-box protein 15
• Database Link:
  NP_689889
  Entrez Gene 201456 Human
  UniProt ID Q8NCQ5
• Background: FBXO15 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO15, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]). [supplied by OMIM]
• Synonyms: FBX15
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome