TNFAIP1 Rabbit Polyclonal Antibody

CAT#: TA338597

Rabbit Polyclonal Anti-Tnfaip1 Antibody

Product Images

Host: Rabbit; Target Name: Tnfaip1; Sample Tissue: Rat Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Tnfaip1 antibody is: synthetic peptide directed towards the C-terminal region of RAT Tnfaip1. Synthetic peptide located within the following region: LNVLLYETPRVPDNSLLEATSRSRSQASPSEDEDTFELRDRVRRIHVKRY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: TNF alpha induced protein 1
• Database Link:
  NP_066960
  Entrez Gene 287543 Rat
  UniProt ID Q13829
• Background: Tnfaip1 is a substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex involved in regulation of cytoskeleton structure. The BCR(BACURD2) E3 ubiquitin ligase complex mediates the ubiquitination of RHOA, leading to its degradation by the proteasome, thereby regulating the actin cytoskeleton and cell migration. Its interaction with RHOB may regulate apoptosis.
• Synonyms: B12; B61; BTBD34; EDP1; hBACURD2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Other