RAET1G Rabbit Polyclonal Antibody

CAT#: TA338350

Rabbit Polyclonal Anti-RAET1G Antibody

Product Images

WB Suggested Anti-RAET1G Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAET1G antibody is: synthetic peptide directed towards the middle region of Human RAET1G. Synthetic peptide located within the following region: HPGARKMKEKWENDKDMTMSFHYISMGDCTGWLEDFLMGMDSTLEPSAGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: retinoic acid early transcript 1G
• Database Link:
  NP_001001788
  Entrez Gene 353091 Human
  UniProt ID Q6H3X3
• Background: Members of the RAET1 family, such as RAET1G, are major histocompatibility complex (MHC) class I-related genes located within a 180-kb cluster on chromosome 6q24.2-q25.3. RAET1 proteins contain MHC class I-like alpha-1 and alpha-2 domains. RAET1E and RAET1G differ from the other RAET1 proteins in that they have type I membrane-spanning sequences at their C termini rather than glycosylphosphatidylinositol anchor sequences.
• Synonyms: ULBP5
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 80%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Natural killer cell mediated cytotoxicity