RAGEF2 (RAPGEF6) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human Rap guanine nucleotide exchange factor (GEF) 6 (RAPGEF6), 20 µg
USD 867.00
Transient overexpression lysate of Rap guanine nucleotide exchange factor (GEF) 6 (RAPGEF6), transcript variant 2
USD 665.00
Other products for "RAGEF2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAPGEF6 antibody is: synthetic peptide directed towards the N-terminal region of Human RAPGEF6. Synthetic peptide located within the following region: GSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQREIPA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 157 kDa |
Gene Name | Rap guanine nucleotide exchange factor 6 |
Database Link | |
Background | RAPGEF6 is a guanine nucleotide exchange factor (GEF) for Rap1A, Rap2A and M-Ras GTPases. RAPGEF6 does not interact with cAMP. |
Synonyms | KIA001LB; PDZ-GEF2; PDZGEF2; RA-GEF-2; RAGEF2 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.