RAGEF2 (RAPGEF6) Rabbit Polyclonal Antibody

CAT#: TA338292

Rabbit Polyclonal Anti-RAPGEF6 Antibody

Product Images

WB Suggested Anti-RAPGEF6 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAPGEF6 antibody is: synthetic peptide directed towards the N-terminal region of Human RAPGEF6. Synthetic peptide located within the following region: GSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQREIPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 157 kDa
• Gene Name: Rap guanine nucleotide exchange factor 6
• Database Link:
  NP_001157861
  Entrez Gene 51735 Human
  UniProt ID Q8TEU7
• Background: RAPGEF6 is a guanine nucleotide exchange factor (GEF) for Rap1A, Rap2A and M-Ras GTPases. RAPGEF6 does not interact with cAMP.
• Synonyms: KIA001LB; PDZ-GEF2; PDZGEF2; RA-GEF-2; RAGEF2
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%