NTH1 (NTHL1) Rabbit Polyclonal Antibody

CAT#: TA338254

Rabbit Polyclonal Anti-NTHL1 Antibody

Product Images

WB Suggested Anti-NTHL1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NTHL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NTHL1. Synthetic peptide located within the following region: DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: nth-like DNA glycosylase 1
• Database Link:
  NP_002519
  Entrez Gene 4913 Human
  UniProt ID P78549
• Background: The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity.
• Synonyms: hNTH1; NTH1; OCTS3
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 93%; Pig: 87%; Dog: 79%; Rat: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Base excision repair