Endomucin (EMCN) Rabbit Polyclonal Antibody

CAT#: TA338051

Rabbit Polyclonal Anti-EMCN Antibody

Product Images

Host: Rabbit; Target Name: EMCN; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EMCN antibody is: synthetic peptide directed towards the N-terminal region of Human EMCN. Synthetic peptide located within the following region: VTILFLLPSICSSNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: endomucin
• Database Link:
  NP_057326
  Entrez Gene 51705 Human
  UniProt ID Q9ULC0
• Background: EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]). [supplied by OMIM, Mar 2008]. Transcript Variant: This variant (2) lacks an in-frame exon in the middle portion of the coding region compared to variant 1. This results in a shorter protein (isoform 2) compared to isoform 1. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## Transcript exon combination :: AK304568.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: EMCN2; MUC14
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane