MUC15 Rabbit Polyclonal Antibody

CAT#: TA337897

Rabbit Polyclonal Anti-MUC15 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Transient overexpression lysate of mucin 15, cell surface associated (MUC15), transcript variant 3
    • 100 ug

USD 436.00

Other products for "MUC15"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MUC15 antibody: synthetic peptide directed towards the middle region of human MUC15. Synthetic peptide located within the following region: KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name mucin 15, cell surface associated
Background May play a role in the cell adhesion to the extracellular matrix.
Synonyms MUC-15; PAS3; PASIII
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Bovine: 90%; Mouse: 85%; Pig: 79%; Horse: 79%; Guinea pig: 79%; Dog: 77%
Reference Data
Protein Families Secreted Protein, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.