MUC15 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of mucin 15, cell surface associated (MUC15), transcript variant 3
USD 436.00
Other products for "MUC15"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MUC15 antibody: synthetic peptide directed towards the middle region of human MUC15. Synthetic peptide located within the following region: KFTNNSKLFPNTSDPQKENRNTGIVFGAILGAILGVSLLTLVGYLLCGKR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 36 kDa |
Gene Name | mucin 15, cell surface associated |
Database Link | |
Background | May play a role in the cell adhesion to the extracellular matrix. |
Synonyms | MUC-15; PAS3; PASIII |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Bovine: 90%; Mouse: 85%; Pig: 79%; Horse: 79%; Guinea pig: 79%; Dog: 77% |
Reference Data | |
Protein Families | Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.