MARK3 Rabbit Polyclonal Antibody

CAT#: TA337660

Rabbit Polyclonal Anti-MARK3 Antibody

Product Images

Sample Type: Lane 1 = 10ug mouse brain extract; Lane 2 = 50ug mouse brain extract; Primary Antibody Dilution: Anti-MARK3 1:2500; Submitted By: Dr. Veronique Dorval, Laval University

• 

  WB Suggested Anti-MARK3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysateMARK3 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MARK3 antibody: synthetic peptide directed towards the middle region of human MARK3. Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: microtubule affinity regulating kinase 3
• Database Link:
  NP_002367
  Entrez Gene 17169 MouseEntrez Gene 4140 Human
  UniProt ID P27448
• Background: MARK3 is involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.
• Synonyms: CTAK1; KP78; Par-1a; PAR1A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase