GPR89B Rabbit Polyclonal Antibody
Frequently bought together (3)
Purified recombinant protein of Human G protein-coupled receptor 89B (GPR89B), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
USD 867.00
Transient overexpression lysate of G protein-coupled receptor 89B (GPR89B)
USD 436.00
Other products for "GPR89B"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GPR89A antibody is: synthetic peptide directed towards the C-terminal region of Human GPR89A. Synthetic peptide located within the following region: LEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 53 kDa |
Gene Name | G protein-coupled receptor 89B |
Database Link | |
Background | GPR89A is a nearly identical copy of the GPR89B gene. |
Synonyms | GPHR; GPR89; GPR89C; SH120; UNQ192 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.