GOLPH3L Rabbit Polyclonal Antibody

CAT#: TA337326

Rabbit Polyclonal Anti-GOLPH3L Antibody

Product Images

Host: Rabbit; Target Name: GOLPH3L; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml GOLPH3L is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GOLPH3L antibody is: synthetic peptide directed towards the N-terminal region of Human GOLPH3L. Synthetic peptide located within the following region: EISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: golgi phosphoprotein 3 like
• Database Link:
  NP_060648
  Entrez Gene 55204 Human
  UniProt ID Q9H4A5
• Background: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking.
• Synonyms: GPP34R
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Mouse: 79%