SAR1B Rabbit Polyclonal Antibody

CAT#: TA336024

Rabbit Polyclonal Anti-SAR1B Antibody

Product Images

WB Suggested Anti-SAR1B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SAR1B Antibody: synthetic peptide directed towards the middle region of human SAR1B. Synthetic peptide located within the following region: RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: secretion associated Ras related GTPase 1B
• Database Link:
  NP_001028675
  Entrez Gene 51128 Human
  UniProt ID Q9Y6B6
• Background: SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.
• Synonyms: ANDD; CMRD; GTBPB; SARA2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%; Yeast: 77%