C18orf32 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of chromosome 18 open reading frame 32 (C18orf32)
USD 436.00
Recombinant protein of human chromosome 18 open reading frame 32 (C18orf32), 20 µg
USD 867.00
Other products for "C18orf32"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-C18orf32 Antibody: synthetic peptide directed towards the middle region of human C18orf32. Synthetic peptide located within the following region: PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 9 kDa |
Gene Name | chromosome 18 open reading frame 32 |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | FLJ23458 |
Note | Immunogen Sequence Homology: Human: 100%; Bovine: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.