OLAH Rabbit Polyclonal Antibody

CAT#: TA335987

Rabbit Polyclonal Anti-OLAH Antibody

Product Images

WB Suggested Anti-OLAH Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HT1080 cell lysate. OLAH is supported by BioGPS gene expression data to be expressed in HT1080

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-OLAH Antibody: synthetic peptide directed towards the N terminal of human OLAH. Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 30 kDa
• Gene Name: oleoyl-ACP hydrolase
• Database Link:
  NP_001034791
  Entrez Gene 55301 Human
  UniProt ID Q9NV23
• Background: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f
• Synonyms: AURA1; SAST; THEDC1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 77%; Rat: 77%; Guinea pig: 77%

Reference Data

• Protein Pathways: Fatty acid biosynthesis, Metabolic pathways