OLAH Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human oleoyl-ACP hydrolase (OLAH), transcript variant 2, 20 µg
USD 867.00
Transient overexpression lysate of oleoyl-ACP hydrolase (OLAH), transcript variant 1
USD 436.00
Other products for "OLAH"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-OLAH Antibody: synthetic peptide directed towards the N terminal of human OLAH. Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 30 kDa |
Gene Name | oleoyl-ACP hydrolase |
Database Link | |
Background | OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f |
Synonyms | AURA1; SAST; THEDC1 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 77%; Rat: 77%; Guinea pig: 77% |
Reference Data | |
Protein Pathways | Fatty acid biosynthesis, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.