TMEM231 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 3, 20 µg
USD 867.00
Transient overexpression lysate of transmembrane protein 231 (TMEM231), transcript variant 1
USD 436.00
Other products for "TMEM231"
Specifications
Product Data | |
Applications | IHC, WB |
Recommended Dilution | WB, IHC |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FLJ22167 Antibody: synthetic peptide directed towards the N terminal of human FLJ22167. Synthetic peptide located within the following region: CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 36 kDa |
Gene Name | transmembrane protein 231 |
Database Link | |
Background | The function remains unknown. |
Synonyms | ALYE870; JBTS20; MKS11; PRO1886 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Zebrafish: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.