DCDC2B Rabbit Polyclonal Antibody

CAT#: TA335917

Rabbit Polyclonal Anti-DCDC2B Antibody

Product Images

Host: Rabbit; Target Name: DCDC2B; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DCDC2B Antibody is: synthetic peptide directed towards the N-terminal region of Human DCDC2B. Synthetic peptide located within the following region: RGQYVAAGFERFHKLHYLPHRGKDPGGKSCRLQGPPVTRHLCDGAIGRQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: doublecortin domain containing 2B
• Database Link:
  NP_001092904
  Entrez Gene 149069 Human
  UniProt ID A2VCK2
• Background: This gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization.
• Synonyms: DCDC2B
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%