FAM32A Rabbit Polyclonal Antibody

CAT#: TA335635

Rabbit Polyclonal Anti-FAM32A Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of family with sequence similarity 32, member A (FAM32A)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human family with sequence similarity 32, member A (FAM32A), 20 µg
    • 20 ug

USD 867.00

Other products for "FAM32A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-FAM32A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM32A. Synthetic peptide located within the following region: DKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKAS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 12 kDa
Gene Name family with sequence similarity 32 member A
Background Isoform 1, but not isoform 2 or isoform 3, may induce G2 arrest and apoptosis. FAM32A may also increase cell sensitivity to apoptotic stimuli.
Synonyms OTAG-12; OTAG12
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 92%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.