CSB (ERCC6) Rabbit Polyclonal Antibody

CAT#: TA335163

Rabbit Polyclonal Anti-ERCC6 Antibody

Product Images

Host: Rabbit; Target Name: ERCC6; Sample Tissue: HepG2 Whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERCC6 antibody is: synthetic peptide directed towards the C-terminal region of Human ERCC6. Synthetic peptide located within the following region: EASALLPTTEHDDLLVEMRNFIAFQAHTDGQASTREILQEFESKLSASQS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 94 kDa
• Gene Name: ERCC excision repair 6, chromatin remodeling factor
• Database Link:
  NP_000115
  Entrez Gene 2074 Human
  UniProt ID Q03468
• Background: The function of this protein remains unknown.
• Synonyms: ARMD5; CKN2; COFS; COFS1; CSB; RAD26; UVSS1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Dog: 79%; Mouse: 79%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Nucleotide excision repair