FKBP51 (FKBP5) Rabbit Polyclonal Antibody

CAT#: TA335070

Rabbit Polyclonal Anti-FKBP5 Antibody

Product Images

Host: Rabbit; Target Name: FKBP5; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FKBP5 antibody is: synthetic peptide directed towards the middle region of Human FKBP5. Synthetic peptide located within the following region: KMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: FK506 binding protein 5
• Database Link:
  NP_004108
  Entrez Gene 14229 MouseEntrez Gene 2289 Human
  UniProt ID Q13451
• Background: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites.
• Synonyms: AIG6; FKBP51; FKBP54; P54; PPIase; Ptg-10
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%

Reference Data

• Protein Families: Druggable Genome