HSPA6 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human heat shock 70kDa protein 6 (HSP70B') (HSPA6), 20 µg
USD 867.00
Other products for "HSPA6"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 71 kDa |
Gene Name | heat shock protein family A (Hsp70) member 6 |
Database Link | |
Background | In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. |
Synonyms | heat shock 70kDa protein 6 (HSP70B'); heat shock 70kD protein 6 (HSP70B') |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 79% |
Reference Data | |
Protein Pathways | Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Spliceosome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.