HNF1 beta (HNF1B) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of HNF1 homeobox B (HNF1B), transcript variant 1
USD 436.00
Other products for "HNF1 beta"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HNF1B antibody: synthetic peptide directed towards the C terminal of human HNF1B. Synthetic peptide located within the following region: QGNNEITSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHNLLSPDGKMIS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 61 kDa |
Gene Name | HNF1 homeobox B |
Database Link | |
Background | HNF1B is a member of the transcription factor superfamily. It forms heterodimers with another member of this transcription factor family, HNF1A. Multiple alternatively spliced transcript variants have been described, however the biological validity all of these variants needs to be determined. |
Synonyms | FJHN; HNF-1-beta; HNF-1B; HNF1beta; HNF2; HPC11; LF-B3; LFB3; MODY5; TCF-2; TCF2; VHNF1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93% |
Reference Data | |
Protein Families | Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways | Maturity onset diabetes of the young |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.