PARP9 Rabbit Polyclonal Antibody

CAT#: TA334269

Rabbit Polyclonal Anti-PARP9 Antibody

Product Images

WB Suggested Anti-PARP9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARP9 antibody: synthetic peptide directed towards the N terminal of human PARP9. Synthetic peptide located within the following region: LHGGGLALALVKAGGFEIQEESKQFVARYGKVSAGEIAVTGAGRLPCKQI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 96 kDa
• Gene Name: poly(ADP-ribose) polymerase family member 9
• Database Link:
  NP_113646
  Entrez Gene 83666 Human
  UniProt ID Q8IXQ6
• Background: PARP9 contains 2 Macro domains and 1 PARP catalytic domain. PARP9 is overexpressed at significantly higher levels in fatal high-risk diffuse large B-cell lymphomas (DLB-CL) compared to cured low-risk tumors. Overexpression of PARP9 in B-cell lymphoma transfectants may promote malignant B-cell migration. The function of PARP9 remains unknown.
• Synonyms: ARTD9; BAL; BAL1; MGC:7868
• Note: Immunogen Sequence Homology: Human: 100%