PARP7 (TIPARP) Rabbit Polyclonal Antibody

CAT#: TA334264

Rabbit Polyclonal Anti-TIPARP Antibody

Product Images

WB Suggested Anti-TIPARP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TIPARP antibody: synthetic peptide directed towards the N terminal of human TIPARP. Synthetic peptide located within the following region: LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFRSRNQSTDENSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: TCDD inducible poly(ADP-ribose) polymerase
• Database Link:
  NP_056323
  Entrez Gene 25976 Human
  UniProt ID Q7Z3E1
• Background: TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor; repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.
• Synonyms: ARTD14; PARP7; pART14
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 92%; Rat: 83%; Mouse: 83%