RGS22 Rabbit Polyclonal Antibody

CAT#: TA333795

Rabbit Polyclonal Anti-RGS22 Antibody

Product Images

WB Suggested Anti-RGS22 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RGS22 Antibody: synthetic peptide directed towards the N terminal of human RGS22. Synthetic peptide located within the following region: QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 147 kDa
• Gene Name: regulator of G-protein signaling 22
• Database Link:
  NP_056483
  Entrez Gene 26166 Human
  UniProt ID Q8NE09
• Background: RGS22 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.
• Synonyms: CT145; PRTD-NY2
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Horse: 93%; Rat: 85%; Pig: 79%