ABRAXAS2 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of family with sequence similarity 175, member B (FAM175B)
USD 436.00
Other products for "ABRAXAS2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FAM175B Antibody: synthetic peptide directed towards the middle region of human FAM175B. Synthetic peptide located within the following region: FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 47 kDa |
Gene Name | family with sequence similarity 175 member B |
Database Link | |
Background | FAM175B is the component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin. It may act as a central scaffold protein that assembles the various components of the BRISC complex. |
Synonyms | ABRO1; KIAA0157 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.