SMRP1 (C9orf24) Rabbit Polyclonal Antibody

CAT#: TA333607

Rabbit Polyclonal Anti-C9orf24 Antibody

Product Images

WB Suggested Anti-C9orf24 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C9orf24 Antibody is: synthetic peptide directed towards the N-terminal region of Human C9orf24. Synthetic peptide located within the following region: MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: chromosome 9 open reading frame 24
• Database Link:
  NP_115985
  Entrez Gene 84688 Human
  UniProt ID Q8NCR6
• Background: This gene encodes a nuclear- or perinuclear-localized protein with no predicted domains or similarity to other known proteins. Expression of this gene is induced during the differentiation of bronchial epithelial cells, and the encoded protein may play a role in ciliogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: bA573M23.4; CBE1; NYD-SP22; SMRP1
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%; Guinea pig: 86%