SMRP1 (C9orf24) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of chromosome 9 open reading frame 24 (C9orf24), transcript variant 1
USD 436.00
Recombinant protein of human chromosome 9 open reading frame 24 (C9orf24), transcript variant 1, 20 µg
USD 867.00
Other products for "SMRP1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-C9orf24 Antibody is: synthetic peptide directed towards the N-terminal region of Human C9orf24. Synthetic peptide located within the following region: MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 29 kDa |
Gene Name | chromosome 9 open reading frame 24 |
Database Link | |
Background | This gene encodes a nuclear- or perinuclear-localized protein with no predicted domains or similarity to other known proteins. Expression of this gene is induced during the differentiation of bronchial epithelial cells, and the encoded protein may play a role in ciliogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Synonyms | bA573M23.4; CBE1; NYD-SP22; SMRP1 |
Note | Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.