SLC38A5 Rabbit Polyclonal Antibody
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "SLC38A5"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SLC38A5 Antibody: synthetic peptide directed towards the N terminal of human SLC38A5. Synthetic peptide located within the following region: GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 51 kDa |
Gene Name | solute carrier family 38 member 5 |
Database Link | |
Background | The protein encoded by this gene is a system N sodium-coupled amino acid transporter. The encoded protein transports glutamine, asparagine, histidine, serine, alanine, and glycine across the cell membrane, but does not transport charged amino acids, imino acids, or N-alkylated amino acids. Alternative splicing results in multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Aug 2013] |
Synonyms | JM24; pp7194; SN2; SNAT5 |
Note | Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Guinea pig: 85% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.