ZNF31 (ZSCAN20) Rabbit Polyclonal Antibody

CAT#: TA333499

Rabbit Polyclonal Anti-ZSCAN20 Antibody

Product Images

WB Suggested Anti-ZSCAN20 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZSCAN20 Antibody: synthetic peptide directed towards the middle region of human ZSCAN20. Synthetic peptide located within the following region: QESSSEEDLEKLIDHQGLYLAEKPYKCDTCMKSFSRSSHFIAHQRIHTGE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 117 kDa
• Gene Name: zinc finger and SCAN domain containing 20
• Database Link:
  NP_660281
  Entrez Gene 7579 Human
  UniProt ID P17040
• Background: ZSCAN20 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers and 1 SCAN box domain. ZSCAN20 may be involved in transcriptional regulation.
• Synonyms: KOX29; ZFP-31; ZNF31; ZNF360
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%

Reference Data

• Protein Families: Transcription Factors