PRR18 Rabbit Polyclonal Antibody

CAT#: TA333442

Rabbit Polyclonal Anti-PRR18 Antibody

Product Images

WB Suggested Anti-PRR18 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRR18 Antibody: synthetic peptide directed towards the N terminal of human PRR18. Synthetic peptide located within the following region: RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: proline rich 18
• Database Link:
  NP_787118
  Entrez Gene 285800 Human
  UniProt ID Q8N4B5
• Background: The exact functions of PRR18 remain unknown.
• Synonyms: MGC35308
• Note: Immunogen sequence homology: Human: 100%