MYLK3 Rabbit Polyclonal Antibody

CAT#: TA333399

Rabbit Polyclonal Anti-MYLK3 Antibody

Product Images

Host: Rabbit; Target Name: MYLK3; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MYLK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK3. Synthetic peptide located within the following region: LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 88 kDa
• Gene Name: myosin light chain kinase 3
• Database Link:
  NP_872299
  Entrez Gene 91807 Human
  UniProt ID Q32MK0
• Background: Phosphorylation of cardiac myosin heavy chains and light chains by a kinase, such as MYLK3, potentiates the force and rate of cross-bridge recruitment in cardiac myocytes.
• Synonyms: caMLCK; MLCK; MLCK2
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Horse: 86%; Pig: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase
• Protein Pathways: Calcium signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Vascular smooth muscle contraction