PFDN1 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human prefoldin subunit 1 (PFDN1), 20 µg
USD 867.00
Other products for "PFDN1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PFDN1 Antibody: synthetic peptide directed towards the N terminal of human PFDN1. Synthetic peptide located within the following region: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 14 kDa |
Gene Name | prefoldin subunit 1 |
Database Link | |
Background | Prefoldin 1 is a heterohexameric chaperone protein which assists in the correct folding of other proteins. It binds specifically to cytosolic chaperonin and transfers target proteins. Prefoldin may function by selectively targeting nascent actin and tubulin chains pending their transfer to cytosolic chaperonin for final folding and/or assembly. It promotes folding in an environment in which there are many competing pathways for nonnative proteins. |
Synonyms | PDF; PFD1 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 92% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.