ZNF324 Rabbit Polyclonal Antibody

CAT#: TA331980

Rabbit Polyclonal Anti-ZNF324 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 324 (ZNF324)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "ZNF324"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ZNF324 Antibody: synthetic peptide directed towards the middle region of human ZNF324. Synthetic peptide located within the following region: TEHALLGRQPRTPERQKPCAQEVPGRTFGSAQDLEAAGGRGHHRMGAVWQ
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 61 kDa
Gene Name zinc finger protein 324
Background ZNF324 belongs to the krueppel C2H2-type zinc-finger protein family.It contains 9 C2H2-type zinc fingers and 1 KRAB domain. ZNF324 may be involved in transcriptional regulation.
Synonyms ZF5128; ZNF324A
Note Immunogen sequence homology: Human: 100%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.