DMRT3 Rabbit Polyclonal Antibody

CAT#: TA331792

Rabbit Polyclonal Anti-DMRT3 Antibody

Product Images

WB Suggested Anti-DMRT3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-DMRT3 Antibody: synthetic peptide directed towards the middle region of human DMRT3. Synthetic peptide located within the following region: ALQAQLAKPDLTEERLGDGKSADNTEVFSDKDTDQRSSPDVAKSKGCFTP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: doublesex and mab-3 related transcription factor 3
• Database Link:
  NP_067063
  Entrez Gene 58524 Human
  UniProt ID Q9NQL9
• Background: DMRT3 may regulate transcription during sexual development.
• Synonyms: DMRTA3
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 79%