PCYOX1L Rabbit Polyclonal Antibody

CAT#: TA331755

Rabbit Polyclonal Anti-PCYOX1L Antibody

Product Images

Host: Rabbit; Target Name: PCYOX1L; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PCYOX1L Antibody is: synthetic peptide directed towards the C-terminal region of Human PCYOX1L. Synthetic peptide located within the following region: ANILTTDFPSFFCTLDNICPVNISASFRRKQPQEAAVWRVQSPKPLFRTQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: prenylcysteine oxidase 1 like
• Database Link:
  NP_076933
  Entrez Gene 78991 Human
  UniProt ID Q8NBM8
• Background: PCYOX1L is a probable oxidoreductase.
• Synonyms: MGC3265
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Zebrafish: 77%