PPM1L Rabbit Polyclonal Antibody

CAT#: TA331661

Rabbit Polyclonal Anti-PPM1L Antibody

Product Images

Host: Rabbit; Target Name: PPM1L; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PPM1L Antibody is: synthetic peptide directed towards the middle region of Human PPM1L. Synthetic peptide located within the following region: SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: protein phosphatase, Mg2+/Mn2+ dependent 1L
• Database Link:
  NP_640338
  Entrez Gene 151742 Human
  UniProt ID Q5SGD2
• Background: PPM1L, or PP2CE, belongs to the PP2C group of serine/threonine phosphatases, which are distinguished from other phosphatases by their structure, absolute requirement for Mg(2+) or Mn(2+), and insensitivity to okadaic acid. PP2Cs regulate stress-activated protein kinase signaling cascades that respond to extracellular stimuli.
• Synonyms: PP2C-epsilon; PP2CE; PPM1-LIKE
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Phosphatase