DNAH12 Rabbit Polyclonal Antibody

CAT#: TA331519

Rabbit Polyclonal Anti-DNAH12 Antibody


USD 539.00

In Stock*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "DNAH12"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-DNAH12 Antibody is: synthetic peptide directed towards the N-terminal region of Human DNAH12. Synthetic peptide located within the following region: LPENIGVDTPTQSKLLKYRRSKEQQQKINQLVIDGAKRNLDRTLGKRTPL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name dynein axonemal heavy chain 12
Background DNAH12 is a force generating protein of respiratory cilia. It produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. DNAH12 is involved in sperm motility; implicated in sperm flagellar assembly
Synonyms DHC3; DLP12; DNAH7L; DNAH12L; DNAHC3; DNAHC12; DNHD2; HDHC3; HL-19; HL19
Note Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Dog: 79%; Horse: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.