PRSS45P Rabbit Polyclonal Antibody

CAT#: TA331511

Rabbit Polyclonal Anti-PRSS45 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of protease, serine, 45 (PRSS45)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "PRSS45"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PRSS45 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS45. Synthetic peptide located within the following region: WILAGVLSWEKACVKAQNPGVYTRITKYTKWIKKQMSNGAFSGPCASACL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name protease, serine 45
Background The function of this protein remains unknown.
Synonyms TESSP5
Note Immunogen sequence homology: Human: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.