Germany
Japan
United Kingdom
China
POTEB3 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (3)
Recombinant protein of human POTE ankyrin domain family, member B (POTEB), 20 µg
USD 867.00
Other products for "POTEB3"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-POTEB Antibody is: synthetic peptide directed towards the C-terminal region of Human POTEB. Synthetic peptide located within the following region: AGNGDDGLIPQRKSRKPENQQFPDTENEEYHSDEQNDTQKQLSEEQNTGI |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 63 kDa |
| Gene Name | POTE ankyrin domain family member B3 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | POTE-15; POTEB |
| Note | Immunogen sequence homology: Human: 100%; Bovine: 82% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.