KCTD6 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1
USD 436.00
Recombinant protein of human potassium channel tetramerisation domain containing 6 (KCTD6), transcript variant 1, 20 µg
USD 867.00
Other products for "KCTD6"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCTD6 antibody: synthetic peptide directed towards the N terminal of human KCTD6. Synthetic peptide located within the following region: LRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 26 kDa |
Gene Name | potassium channel tetramerization domain containing 6 |
Database Link | |
Background | KCTD6 is a domain of potassium channel |
Synonyms | KCASH3 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85% |
Reference Data | |
Protein Families | Ion Channels: Other |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.