TOR1AIP2 Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of torsin A interacting protein 2 (TOR1AIP2), transcript variant 2
USD 436.00
Recombinant protein of human torsin A interacting protein 2 (TOR1AIP2), 20 µg
USD 867.00
Other products for "TOR1AIP2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TOR1AIP2 antibody is: synthetic peptide directed towards the N-terminal region of Human TOR1AIP2. Synthetic peptide located within the following region: PDEANVGKHPKDKTEDENKQSFLDGGKGHHLPSENLGKEPLDPDPSHSPS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 51 kDa |
Gene Name | torsin 1A interacting protein 2 |
Database Link | |
Background | TOR1AIP2 regulates the distribution of TOR1A between the endoplasmic reticulum and the nuclear envelope. |
Synonyms | IFRG15; LULL1; NET9 |
Note | Rat: 100%; Human: 100%; Yeast: 100%; Dog: 83%; Horse: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.