TTC39C Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human tetratricopeptide repeat domain 39C (TTC39C), transcript variant 1, 20 µg
USD 867.00
Transient overexpression lysate of tetratricopeptide repeat domain 39C (TTC39C), transcript variant 1
USD 436.00
Other products for "TTC39C"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TTC39C antibody is: synthetic peptide directed towards the middle region of Human TTC39C. Synthetic peptide located within the following region: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 59 kDa |
Gene Name | tetratricopeptide repeat domain 39C |
Database Link | |
Background | The function of this protein remains unknown. |
Synonyms | C18orf17; HsT2697 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.