CDC34 Rabbit Polyclonal Antibody

CAT#: TA330370

Rabbit Polyclonal Anti-CDC34 Antibody

Product Images

WB Suggested Anti-CDC34 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDC34 antibody: synthetic peptide directed towards the middle region of human CDC34. Synthetic peptide located within the following region: TLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: cell division cycle 34
• Database Link:
  NP_004350
  Entrez Gene 997 Human
  UniProt ID P49427
• Background: CDC34 catalyzes the covalent attachment of ubiquitin to other proteins. CDC34 may be involved in degradation of katenin.The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: E2-CDC34; UBC3; UBCH3; UBE2R1
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 92%; Rat: 92%; Chicken: 78%

Reference Data

• Protein Pathways: Ubiquitin mediated proteolysis