EGR2 Rabbit Polyclonal Antibody

CAT#: TA330111

Rabbit Polyclonal Anti-EGR2 Antibody

Product Images

WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Lung

• 

  Human Intestine

• 

  Rabbit Anti-EGR2 Antibody; Paraffin Embedded Tissue: Human bronchiole epithelium; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EGR2 antibody: synthetic peptide directed towards the C terminal of human EGR2. Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: early growth response 2
• Database Link:
  NP_000390
  Entrez Gene 13654 MouseEntrez Gene 114090 RatEntrez Gene 1959 Human
  UniProt ID P11161
• Background: The early growth response protein 2 (EGR2) is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1.The early growth response protein 2 is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: AT591; CMT1D; CMT4E; KROX20
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors