RAB3D Rabbit Polyclonal Antibody

CAT#: TA330003

Rabbit Polyclonal Anti-RAB3D Antibody

Product Images

WB Suggested Anti-RAB3D Antibody Titration: 2.5ug/ml; Positive Control: Transfected 293T

• 

  WB Suggested Anti-RAB3D Antibody ; Positive Control: Lane 1: BCAM0379 protein from B cenocepacia; Primary Antibody Dilution : 1:5000; Secondary Antibody : Anti-rabbit-HRP; Secondry Antibody Dilution : 1:5000; Submitted by: Katie Nurse

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAB3D antibody: synthetic peptide directed towards the C terminal of human RAB3D. Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: RAB3D, member RAS oncogene family
• Database Link:
  NP_004274
  Entrez Gene 9545 Human
  UniProt ID O95716
• Background: As a protein transport, RAB3D is probably involved in regulated exocytosis.
• Synonyms: D2-2; GOV; RAB16; RAD3D
• Note: Immunogen sequence homology: Human: 100%; Bovine: 86%; Rabbit: 86%; Mouse: 80%; Rat: 80%

Reference Data

• Protein Families: Druggable Genome