RAB3D Rabbit Polyclonal Antibody
Frequently bought together (2)
Other products for "RAB3D"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAB3D antibody: synthetic peptide directed towards the C terminal of human RAB3D. Synthetic peptide located within the following region: KENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 24 kDa |
Gene Name | RAB3D, member RAS oncogene family |
Database Link | |
Background | As a protein transport, RAB3D is probably involved in regulated exocytosis. |
Synonyms | D2-2; GOV; RAB16; RAD3D |
Note | Immunogen sequence homology: Human: 100%; Bovine: 86%; Rabbit: 86%; Mouse: 80%; Rat: 80% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.